EMAIL: peptide-online@hotmail.com | Product Catalog
Product  >  Other Peptide  >  Fibronectin-Binding Protein
Fibronectin-Binding Protein Related Products
Catalog No. Peptide Name Size Price M. W Purity Stock
P80037Pe2 Fibronectin-Binding Protein 5mg USD 592 4309.7 > 98% In Stock Inquiry
P80037Pe2 Fibronectin-Binding Protein 10mg USD 666 4309.7 > 98% In Stock Inquiry
P80037Pe2 Fibronectin-Binding Protein 20mg USD 925 4309.7 > 98% In Stock Inquiry
P80037Pe2 Fibronectin-Binding Protein 50mg USD 1554 4309.7 > 98% In Stock Inquiry
P80037Pe2 Fibronectin-Binding Protein 100mg USD 2220 4309.7 > 98% 1-3 days Inquiry
P80037Pe2 Fibronectin-Binding Protein 200mg USD 2960 4309.7 > 98% 3-5 days Inquiry
P80037Pe2 Fibronectin-Binding Protein 500mg USD 3700 4309.7 > 98% 1-2 weeks Inquiry
P80037Pe2 Fibronectin-Binding Protein 1000mg USD 5550 4309.7 > 98% 1-2 weeks Inquiry
Overview
Product Name: Fibronectin-Binding Protein
Synonym:
Catalog No.:P80037Pe2
CAS No.:119977-20-7
Sequence(one-letter):FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV
Sequence(three-letter):Phe-Asn-Lys-His-Thr-Glu-Ile-Ile-Glu-Glu-Asp-Thr-Asn-Lys-Asp-Lys-Pro-Ser-Tyr-Gln-Phe-Gly-Gly-His-Asn-Ser-Val-Asp-Phe-Glu-Glu-Asp-Thr-Leu-Pro-Lys-Val
Molecular Formula:C190H283N49O66
Molecular Weight:4309.7
Purity:> 98%
Storage instructions:Stored at 2-8oC. Store under Desiccating conditions. The product can be stored for up to 12 months.
Description:Synthetic peptide that mimics the structure of a 38-amino acid unit from a staphylococcal fibronectin-binding protein. This peptide represents the protein domain to which the fibronectin-binding activity has been localized and also inhibits binding of fibronectin to bacterial cells.
Leave a message: eg: mail@mail.com 
After receiving:
The packaging of the product may have turned upside down during transportation, resulting in the natural compounds adhering to the neck or cap of the vial. take the vial out of its packaging and gently shake to let the compounds fall to the bottom of the vial. for liquid products, centrifuge at 200-500 RPM to gather the liquid at the bottom of the vial. try to avoid loss or contamination during handling.
Note:
1. It is recommended that the concentration of the stock solution be around 1-2 mg of peptide per ml of solution. This is dilute enough to minimize the potential precipitation of the peptides during storage, but concentrated enough to take relatively small volumes (< 100 µl) of aliquots for the assay, and therefore minimizing the effect of the solvents initially used for solubilization.

2. Stability of peptides have no uniform standards. The stability of each peptide depends on its sequence information. We suggest Lyophilized peptides should be stored at -20 °C. It is recommended that peptides containing methionine, cysteine, or tryptophan residues be stored in oxygen-free atmosphere to avoid oxidation.

Peptide-online products have been sold to research institutions and universities.

  • VIT University
  • Complutense University of Madrid
  • University of Hawaii
  • Universidade Federal de Goias
  • Sapienza University of Rome
  • University of Mainz

    • Delivery

    1. Delivery will be initiated within 24 hours if your requested items are in stock. The transit time is approximately 2-3 business days.
    2. In the event items are out of stock, we will arrange to replenish our stock within 24 hours and we will keep you informed of the delivery status via email or phone.

    Shipping Rates

    1. The shipping and handling fee is 50 USD.
    2. The requested items will be shipped directly to you via FedEx, DHL or EMS.
    3. Packages and products should be inspected immediately upon reception. Notification of damage, shortage or defects should be sent to us immediately by e-mail or fax.

    Quick Contact

    If you find the right products of peptide-online, please do not hesitate to contact me!

    Tel: +86-27-84396673
    Fax: +86-27-84254680
    Email: peptide-online@hotmail.com
    Website: www.peptide-online.com

    © Copyright 2011 Peptide-online.com. All Rights Reserved