Fibronectin and Extra Cellular Matrix Related Pept |

Product > Other Peptide > Fibronectin and Extra Cellular Matrix Related Pept

Fibronectin and Extra Cellular Matrix Related Pept

Fibronectin is a high-molecular weight (~440kDa) glycoprotein of the extracellular matrix that binds to membrane-spanning receptor proteins called integrins. Similar to integrins, fibronectin binds extracellular matrix components such as collagen, fibrin, and heparan sulfate proteoglycans (e.g. syndecans).

Fibronectin exists as a protein dimer, consisting of two nearly identical monomers linked by a pair of disulfide bonds. The fibronectin protein is produced from a single gene, but alternative splicing of its pre-mRNA leads to the creation of several isoforms.

Two types of fibronectin are present in vertebrates:

soluble plasma fibronectin (formerly called "cold-insoluble globulin", or CIg) is a major protein component of blood plasma (300 μg/ml) and is produced in the liver by hepatocytes.

insoluble cellular fibronectin is a major component of the extracellular matrix. It is secreted by various cells, primarily fibroblasts, as a soluble protein dimer and is then assembled into an insoluble matrix in a complex cell-mediated process.

Fibronectin plays a major role in cell adhesion, growth, migration, and differentiation, and it is important for processes such as wound healing and embryonic development. Altered fibronectin expression, degradation, and organization has been associated with a number of pathologies, including cancer and fibrosis.

Catalog No.	Peptide Name	Sequence	Purity
P80037Pe1	G-R-G-D-S-P	GRGDSP	> 98%
P80037Pe2	Fibronectin-Binding Protein	FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV	> 98%
P80037Hu1	[Tyr0] Fibrinopeptide A, Human	YADSGEGDFLAEGGGVR	> 98%
P80037Hu2	[Glu1] Fibrinopeptide B, Human	EGVNDNEEGFFSAR	> 98%
P80037Pe3	(NMe)G-R-G-D-S-P	Sar-RGDSP	> 98%
P80037Hu3	Fibrinopeptide B, Human	Glp-GVNDNEEGFFSAR	> 98%
P80037Pe4	G-R-G-D-S	GRGDS	> 98%
P80037Pe5	G-R-G-D-S-P-C	GRGDSPC	> 98%
P80037Pe6	Fibronectin CS1 Peptide	EILDVPST	> 98%
P80037Pe7	G-Pen-G-R-G-D-S-P-C-A	G-Pen-GRGDSPC-Ala(Pen2&Cys9 bridge)	> 98%
P80037Pe8	Collagen Binding Fragment	CQDSETRTFY	> 98%
P80037Pe9	G-dR-G-D-S-P-A-S-S-K	G-DArg-GDSPASSK	> 98%

Delivery

1. Delivery will be initiated within 24 hours if your requested items are in stock. The transit time is approximately 2-3 business days.
2. In the event items are out of stock, we will arrange to replenish our stock within 24 hours and we will keep you informed of the delivery status via email or phone.

Shipping Rates

1. The shipping and handling fee is 50 USD.
2. The requested items will be shipped directly to you via FedEx, DHL or EMS.
3. Packages and products should be inspected immediately upon reception. Notification of damage, shortage or defects should be sent to us immediately by e-mail or fax.

Quick Contact

If you find the right products of peptide-online, please do not hesitate to contact me!

Tel: +86-27-84396673
Fax: +86-27-84254680
Email: peptide-online@hotmail.com
Website: www.peptide-online.com