Antimicrobial peptides (AMPs), also called host defense peptides (HDPs) are part of the innate immune response found among all classes of life. Fundamental differences exist between prokaryotic and eukaryotic cells that may represent targets for antimicrobial peptides. These peptides are potent, broad spectrum antibiotics which demonstrate potential as novel therapeutic agents. Antimicrobial peptides have been demonstrated to kill Gram negative and Gram positive bacteria, enveloped viruses, fungi and even transformed or cancerous cells. Unlike the majority of conventional antibiotics it appears as though antimicrobial peptides may also have the ability to enhance immunity by functioning as immunomodulators.
| Catalog No. | Peptide Name | Sequence | Purity |
|---|---|---|---|
| P80017Pe1 | Histatin-5 | DSHAKRHHGYKRKFHEKHHSHRGY | > 98% |
| P80017Pe2 | Magainin 1 | GIGKFLHSAGKFGKAFVGEIMKS | > 98% |
| P80017Po1 | Cecropin A, Porcine | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH... | > 98% |
| P80017Pe3 | Anti-Inflammatory Peptide 1 | MQMKKVLDS | > 98% |
| P80017Pe4 | Anti-Inflammatory Peptide 3 | MQMNKVLDS | > 98% |
| P80017Pe5 | Cecropin B | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2 | > 98% |
| P80017Bo1 | Lactoferricin, Bovine, (BLFC) | RRWQWRMKKLG | > 98% |
| P80017Po2 | Cecropin P1, Porcine | SWLSKTAKKLENSAKKRISEGIAIAIQGGPR | > 98% |
| P80017Pe6 | Dermaseptin | ALWKTMLKKLGTMALHAGKAALGAAADTISQGTQ | > 98% |
| P80017Pe7 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | > 98% |
| P80017Pe8 | Cecropin A-melittin hybrid peptide [CA(1-7)M(2-9)NH2] | KWKLFKKIGAVLKVL-NH2 | > 98% |
| P80017Pe9 | Anti-Inflammatory Peptide 2 | HDMNKVLDL | > 98% |
1. Delivery will be initiated within 24 hours if your requested items are in stock. The transit time is approximately 2-3 business days.
2. In the event items are out of stock, we will arrange to replenish our stock within 24 hours and we will keep you informed of the delivery status via email or phone.
1. The shipping and handling fee is 50 USD.
2. The requested items will be shipped directly to you via FedEx, DHL or EMS.
3. Packages and products should be inspected immediately upon reception. Notification of damage, shortage or defects should be sent to us immediately by e-mail or fax.
If you find the right products of peptide-online, please do not hesitate to contact me!
Tel: +86-27-84396673
Fax: +86-27-84254680
Email: peptide-online@hotmail.com
Website: www.peptide-online.com