EMAIL: peptide-online@hotmail.com | Product Catalog
Product  >  Other Peptide  >  Urocortin II, Mouse
Urocortin II, Mouse Related Products
Catalog No. Peptide Name Size Price M. W Purity Stock
P80081Mu2 Urocortin II, Mouse 5mg USD 608 4153 > 98% In Stock Inquiry
P80081Mu2 Urocortin II, Mouse 10mg USD 684 4153 > 98% In Stock Inquiry
P80081Mu2 Urocortin II, Mouse 20mg USD 950 4153 > 98% In Stock Inquiry
P80081Mu2 Urocortin II, Mouse 50mg USD 1596 4153 > 98% In Stock Inquiry
P80081Mu2 Urocortin II, Mouse 100mg USD 2280 4153 > 98% 1-3 days Inquiry
P80081Mu2 Urocortin II, Mouse 200mg USD 3040 4153 > 98% 3-5 days Inquiry
P80081Mu2 Urocortin II, Mouse 500mg USD 3800 4153 > 98% 1-2 weeks Inquiry
P80081Mu2 Urocortin II, Mouse 1000mg USD 5700 4153 > 98% 1-2 weeks Inquiry
Overview
Product Name: Urocortin II, Mouse(Mouse)
Synonym:
Catalog No.:P80081Mu2
CAS No.:330648-32-3
Sequence(one-letter):VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV-NH2
Sequence(three-letter):Val-Ile-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Arg-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Tyr-Lys-Ala-Ala-Arg-Asn-Gln-Ala-Ala-Thr-Asn-Ala-Gln-Ile-Leu-Ala-His-Val-NH2
Molecular Formula:C187H320N56O50
Molecular Weight:4153
Purity:> 98%
Storage instructions:Stored at 2-8oC. Store under Desiccating conditions. The product can be stored for up to 12 months.
Description:This peptide has exhibited considerably higher affinity for both splice variants of the type 2 CRF receptor (CRF-R2) than for those of CRF-R1. The potencies of Ucn II (mouse) in activating CRF-R2a and CRF-R2b were almost the same to that of urocortin (rat).
Leave a message: eg: mail@mail.com 
After receiving:
The packaging of the product may have turned upside down during transportation, resulting in the natural compounds adhering to the neck or cap of the vial. take the vial out of its packaging and gently shake to let the compounds fall to the bottom of the vial. for liquid products, centrifuge at 200-500 RPM to gather the liquid at the bottom of the vial. try to avoid loss or contamination during handling.
Note:
1. It is recommended that the concentration of the stock solution be around 1-2 mg of peptide per ml of solution. This is dilute enough to minimize the potential precipitation of the peptides during storage, but concentrated enough to take relatively small volumes (< 100 µl) of aliquots for the assay, and therefore minimizing the effect of the solvents initially used for solubilization.

2. Stability of peptides have no uniform standards. The stability of each peptide depends on its sequence information. We suggest Lyophilized peptides should be stored at -20 °C. It is recommended that peptides containing methionine, cysteine, or tryptophan residues be stored in oxygen-free atmosphere to avoid oxidation.

Peptide-online products have been sold to research institutions and universities.

  • Monash University Malaysia
  • Yale University
  • Universidad de Antioquia
  • Universidad de Ciencias y Artes de Chiapas
  • University of Mysore
  • Complutense University of Madrid

    • Delivery

    1. Delivery will be initiated within 24 hours if your requested items are in stock. The transit time is approximately 2-3 business days.
    2. In the event items are out of stock, we will arrange to replenish our stock within 24 hours and we will keep you informed of the delivery status via email or phone.

    Shipping Rates

    1. The shipping and handling fee is 50 USD.
    2. The requested items will be shipped directly to you via FedEx, DHL or EMS.
    3. Packages and products should be inspected immediately upon reception. Notification of damage, shortage or defects should be sent to us immediately by e-mail or fax.

    Quick Contact

    If you find the right products of peptide-online, please do not hesitate to contact me!

    Tel: +86-27-84396673
    Fax: +86-27-84254680
    Email: peptide-online@hotmail.com
    Website: www.peptide-online.com

    © Copyright 2011 Peptide-online.com. All Rights Reserved