EMAIL: peptide-online@hotmail.com | Product Catalog
Product  >  Other Peptide  >  Peptide YY, PYY, Porcine
Peptide YY, PYY, Porcine Related Products
Catalog No. Peptide Name Size Price M. W Purity Stock
P80070Po1 Peptide YY, PYY, Porcine 5mg USD 576 4240.7 > 98% In Stock Inquiry
P80070Po1 Peptide YY, PYY, Porcine 10mg USD 648 4240.7 > 98% In Stock Inquiry
P80070Po1 Peptide YY, PYY, Porcine 20mg USD 900 4240.7 > 98% In Stock Inquiry
P80070Po1 Peptide YY, PYY, Porcine 50mg USD 1512 4240.7 > 98% In Stock Inquiry
P80070Po1 Peptide YY, PYY, Porcine 100mg USD 2160 4240.7 > 98% 1-3 days Inquiry
P80070Po1 Peptide YY, PYY, Porcine 200mg USD 2880 4240.7 > 98% 3-5 days Inquiry
P80070Po1 Peptide YY, PYY, Porcine 500mg USD 3600 4240.7 > 98% 1-2 weeks Inquiry
P80070Po1 Peptide YY, PYY, Porcine 1000mg USD 5400 4240.7 > 98% 1-2 weeks Inquiry
Overview
Product Name: Peptide YY, PYY, Porcine(Porcine)
Synonym:
Catalog No.:P80070Po1
CAS No.:
Sequence(one-letter):YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2
Sequence(three-letter):Tyr-Pro-Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
Molecular Formula:C190H288N54O57
Molecular Weight:4240.7
Purity:> 98%
Storage instructions:Stored at 2-8oC. Store under Desiccating conditions. The product can be stored for up to 12 months.
Description:
Leave a message: eg: mail@mail.com 
After receiving:
The packaging of the product may have turned upside down during transportation, resulting in the natural compounds adhering to the neck or cap of the vial. take the vial out of its packaging and gently shake to let the compounds fall to the bottom of the vial. for liquid products, centrifuge at 200-500 RPM to gather the liquid at the bottom of the vial. try to avoid loss or contamination during handling.
Note:
1. It is recommended that the concentration of the stock solution be around 1-2 mg of peptide per ml of solution. This is dilute enough to minimize the potential precipitation of the peptides during storage, but concentrated enough to take relatively small volumes (< 100 µl) of aliquots for the assay, and therefore minimizing the effect of the solvents initially used for solubilization.

2. Stability of peptides have no uniform standards. The stability of each peptide depends on its sequence information. We suggest Lyophilized peptides should be stored at -20 °C. It is recommended that peptides containing methionine, cysteine, or tryptophan residues be stored in oxygen-free atmosphere to avoid oxidation.

Peptide-online products have been sold to research institutions and universities.

  • University of Helsinki
  • University of Padjajaran
  • University of Parma
  • Mahatma Gandhi University
  • Chulalongkorn University
  • Pennsylvania State University
  • Delivery

    1. Delivery will be initiated within 24 hours if your requested items are in stock. The transit time is approximately 2-3 business days.
    2. In the event items are out of stock, we will arrange to replenish our stock within 24 hours and we will keep you informed of the delivery status via email or phone.

    Shipping Rates

    1. The shipping and handling fee is 50 USD.
    2. The requested items will be shipped directly to you via FedEx, DHL or EMS.
    3. Packages and products should be inspected immediately upon reception. Notification of damage, shortage or defects should be sent to us immediately by e-mail or fax.

    Quick Contact

    If you find the right products of peptide-online, please do not hesitate to contact me!

    Tel: +86-27-84396673
    Fax: +86-27-84254680
    Email: peptide-online@hotmail.com
    Website: www.peptide-online.com