EMAIL: peptide-online@hotmail.com | Product Catalog
Product  >  Other Peptide  >  LL-37
LL-37 Related Products
Catalog No. Peptide Name Size Price M. W Purity Stock
P80144Pe1 LL-37 5mg USD 592 4493.33 > 98% In Stock Inquiry
P80144Pe1 LL-37 10mg USD 666 4493.33 > 98% In Stock Inquiry
P80144Pe1 LL-37 20mg USD 925 4493.33 > 98% In Stock Inquiry
P80144Pe1 LL-37 50mg USD 1554 4493.33 > 98% In Stock Inquiry
P80144Pe1 LL-37 100mg USD 2220 4493.33 > 98% 1-3 days Inquiry
P80144Pe1 LL-37 200mg USD 2960 4493.33 > 98% 3-5 days Inquiry
P80144Pe1 LL-37 500mg USD 3700 4493.33 > 98% 1-2 weeks Inquiry
P80144Pe1 LL-37 1000mg USD 5550 4493.33 > 98% 1-2 weeks Inquiry
Overview
Product Name: LL-37
Synonym:
Catalog No.:P80144Pe1
CAS No.:154947-66-7
Sequence(one-letter):H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OHTrifluoroacetate salt
Sequence(three-letter):H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OHTrifluoroacetate salt
Molecular Formula:C205H340N60O53
Molecular Weight:4493.33
Purity:> 98%
Storage instructions:Stored at 2-8oC. Store under Desiccating conditions. The product can be stored for up to 12 months.
Description:LL-37 is an antimicrobial peptide with angiogenic activity. It corresponds to the C-terminal sequence (134-170) of the human cathelicidin antimicrobial protein hCAP18/LL-37 and is extracellularly released from hCAP18/LL-37 by proteolytic processing. hCAP18/LL-37 is an effector of the innate immune system and is expressed in leukocytes and epithelial cells where it is upregulated in association with inflammation and injury. An overexpression of hCAP18/LL-37 in a series of breast carcinomas could be demonstated. LL-37 has been suggested to stimulate epithelial cell proliferation partially through formyl peptide receptor-like 1 (FPRL1) since blocking the receptor with pertussis toxin decreased the proliferative effect of LL-37 by approximately 50 %.
Leave a message: eg: mail@mail.com 
After receiving:
The packaging of the product may have turned upside down during transportation, resulting in the natural compounds adhering to the neck or cap of the vial. take the vial out of its packaging and gently shake to let the compounds fall to the bottom of the vial. for liquid products, centrifuge at 200-500 RPM to gather the liquid at the bottom of the vial. try to avoid loss or contamination during handling.
Note:
1. It is recommended that the concentration of the stock solution be around 1-2 mg of peptide per ml of solution. This is dilute enough to minimize the potential precipitation of the peptides during storage, but concentrated enough to take relatively small volumes (< 100 µl) of aliquots for the assay, and therefore minimizing the effect of the solvents initially used for solubilization.

2. Stability of peptides have no uniform standards. The stability of each peptide depends on its sequence information. We suggest Lyophilized peptides should be stored at -20 °C. It is recommended that peptides containing methionine, cysteine, or tryptophan residues be stored in oxygen-free atmosphere to avoid oxidation.

Peptide-online products have been sold to research institutions and universities.

  • Aarhus University
  • Universidade Federal de Pernambuco
  • Srinakharinwirot University
  • University of Minnesota
  • University of the Basque Country
  • Griffith University

    • Delivery

    1. Delivery will be initiated within 24 hours if your requested items are in stock. The transit time is approximately 2-3 business days.
    2. In the event items are out of stock, we will arrange to replenish our stock within 24 hours and we will keep you informed of the delivery status via email or phone.

    Shipping Rates

    1. The shipping and handling fee is 50 USD.
    2. The requested items will be shipped directly to you via FedEx, DHL or EMS.
    3. Packages and products should be inspected immediately upon reception. Notification of damage, shortage or defects should be sent to us immediately by e-mail or fax.

    Quick Contact

    If you find the right products of peptide-online, please do not hesitate to contact me!

    Tel: +86-27-84396673
    Fax: +86-27-84254680
    Email: peptide-online@hotmail.com
    Website: www.peptide-online.com

    © Copyright 2011 Peptide-online.com. All Rights Reserved