EMAIL: peptide-online@hotmail.com | Product Catalog
Product  >  Other Peptide  >  Intermedin, Rat
Intermedin, Rat Related Products
Catalog No. Peptide Name Size Price M. W Purity Stock
P80139Ra1 Intermedin, Rat 5mg USD 752 5216.95 > 98% In Stock Inquiry
P80139Ra1 Intermedin, Rat 10mg USD 846 5216.95 > 98% In Stock Inquiry
P80139Ra1 Intermedin, Rat 20mg USD 1175 5216.95 > 98% In Stock Inquiry
P80139Ra1 Intermedin, Rat 50mg USD 1974 5216.95 > 98% In Stock Inquiry
P80139Ra1 Intermedin, Rat 100mg USD 2820 5216.95 > 98% 1-3 days Inquiry
P80139Ra1 Intermedin, Rat 200mg USD 3760 5216.95 > 98% 3-5 days Inquiry
P80139Ra1 Intermedin, Rat 500mg USD 4700 5216.95 > 98% 1-2 weeks Inquiry
P80139Ra1 Intermedin, Rat 1000mg USD 7050 5216.95 > 98% 1-2 weeks Inquiry
Overview
Product Name: Intermedin, Rat(Rat)
Synonym:
Catalog No.:P80139Ra1
CAS No.:
Sequence(one-letter):PHAQLLRVGCVLGTCQVQNLSHRLWQLVRPSGRRDSAPVDPSSPHSY-NH2
Sequence(three-letter):Pro-His-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Val-Arg-Pro-Ser-Gly-Arg-Arg-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser-Tyr-NH2(Disulfide bond Cys10-Cys15) Trifluoroacetate salt
Molecular Formula:C226H361N75O64S2
Molecular Weight:5216.95
Purity:> 98%
Storage instructions:Stored at 2-8oC. Store under Desiccating conditions. The product can be stored for up to 12 months.
Description:Intermedins are members of the calcitonin/CGRP family. In vitro studies have shown that the synthetic 47 amino acid intermedin peptides act through the calcitonin receptor-like receptor/receptor activity-modifying protein (CRLR/RAMP) complexes by increasing intracellular cAMP levels. Unlike calcitonin gene-related peptide (CGRP) and adrenomedullin (ADM) intermedin exhibited no preference for one of the three RAMPs when co-expressed with CRLR.In normal and spontaneously hypertensive rats it has been demonstrated that intermedin treatment results in blood pressure reduction which can be blocked by the CGRP receptor antagonist CGRP (8-37). Apart from the hypotensive action, synthetic intermedin has also been shown to inhibit gastric emptying and food intake in mice.Therefore, intermedin represents an additional regulator of gastrointestinal and cardiovascular functions and might be involved in other bioactivities mediated by the CRLR/RAMP receptor complexes.
Leave a message: eg: mail@mail.com 
After receiving:
The packaging of the product may have turned upside down during transportation, resulting in the natural compounds adhering to the neck or cap of the vial. take the vial out of its packaging and gently shake to let the compounds fall to the bottom of the vial. for liquid products, centrifuge at 200-500 RPM to gather the liquid at the bottom of the vial. try to avoid loss or contamination during handling.
Note:
1. It is recommended that the concentration of the stock solution be around 1-2 mg of peptide per ml of solution. This is dilute enough to minimize the potential precipitation of the peptides during storage, but concentrated enough to take relatively small volumes (< 100 µl) of aliquots for the assay, and therefore minimizing the effect of the solvents initially used for solubilization.

2. Stability of peptides have no uniform standards. The stability of each peptide depends on its sequence information. We suggest Lyophilized peptides should be stored at -20 °C. It is recommended that peptides containing methionine, cysteine, or tryptophan residues be stored in oxygen-free atmosphere to avoid oxidation.

Peptide-online products have been sold to research institutions and universities.

  • University of Fribourg
  • University of Wollongong
  • University of Basel
  • Mendel University in Brno
  • Texas A&M University
  • Utrecht University
  • Delivery

    1. Delivery will be initiated within 24 hours if your requested items are in stock. The transit time is approximately 2-3 business days.
    2. In the event items are out of stock, we will arrange to replenish our stock within 24 hours and we will keep you informed of the delivery status via email or phone.

    Shipping Rates

    1. The shipping and handling fee is 50 USD.
    2. The requested items will be shipped directly to you via FedEx, DHL or EMS.
    3. Packages and products should be inspected immediately upon reception. Notification of damage, shortage or defects should be sent to us immediately by e-mail or fax.

    Quick Contact

    If you find the right products of peptide-online, please do not hesitate to contact me!

    Tel: +86-27-84396673
    Fax: +86-27-84254680
    Email: peptide-online@hotmail.com
    Website: www.peptide-online.com