EMAIL: peptide-online@hotmail.com | Product Catalog
Product  >  Other Peptide  >  Glucagon-Like Peptide II, Rat
Glucagon-Like Peptide II, Rat Related Products
Catalog No. Peptide Name Size Price M. W Purity Stock
P80043Ra1 Glucagon-Like Peptide II, Rat 5mg USD 528 3796.2 > 98% In Stock Inquiry
P80043Ra1 Glucagon-Like Peptide II, Rat 10mg USD 594 3796.2 > 98% In Stock Inquiry
P80043Ra1 Glucagon-Like Peptide II, Rat 20mg USD 825 3796.2 > 98% In Stock Inquiry
P80043Ra1 Glucagon-Like Peptide II, Rat 50mg USD 1386 3796.2 > 98% In Stock Inquiry
P80043Ra1 Glucagon-Like Peptide II, Rat 100mg USD 1980 3796.2 > 98% 1-3 days Inquiry
P80043Ra1 Glucagon-Like Peptide II, Rat 200mg USD 2640 3796.2 > 98% 3-5 days Inquiry
P80043Ra1 Glucagon-Like Peptide II, Rat 500mg USD 3300 3796.2 > 98% 1-2 weeks Inquiry
P80043Ra1 Glucagon-Like Peptide II, Rat 1000mg USD 4950 3796.2 > 98% 1-2 weeks Inquiry
Overview
Product Name: Glucagon-Like Peptide II, Rat(Rat)
Synonym:
Catalog No.:P80043Ra1
CAS No.:
Sequence(one-letter):HADGSFSDEMNTILDNLATRDFINWLIQTKITD
Sequence(three-letter):His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp
Molecular Formula:C166H256N44O56S1
Molecular Weight:3796.2
Purity:> 98%
Storage instructions:Stored at 2-8oC. Store under Desiccating conditions. The product can be stored for up to 12 months.
Description:GLP-2 increases the stimulation of crypt cell proliferation and inhibition of enterocyte apoptosis, leading to hyperplasia of the small bowel villous epithelium. It also induces trophic effects in animal models of both small and large bowel injury such as experimental small bowel resection or chemically induced colitis. Besides stimulation of epithelial proliferation, GLP-2 acutely regulates gastric emptying and possesses rapid metabolic effects promoting the stimulation of intestinal hexose transport.
Leave a message: eg: mail@mail.com 
After receiving:
The packaging of the product may have turned upside down during transportation, resulting in the natural compounds adhering to the neck or cap of the vial. take the vial out of its packaging and gently shake to let the compounds fall to the bottom of the vial. for liquid products, centrifuge at 200-500 RPM to gather the liquid at the bottom of the vial. try to avoid loss or contamination during handling.
Note:
1. It is recommended that the concentration of the stock solution be around 1-2 mg of peptide per ml of solution. This is dilute enough to minimize the potential precipitation of the peptides during storage, but concentrated enough to take relatively small volumes (< 100 µl) of aliquots for the assay, and therefore minimizing the effect of the solvents initially used for solubilization.

2. Stability of peptides have no uniform standards. The stability of each peptide depends on its sequence information. We suggest Lyophilized peptides should be stored at -20 °C. It is recommended that peptides containing methionine, cysteine, or tryptophan residues be stored in oxygen-free atmosphere to avoid oxidation.

Peptide-online products have been sold to research institutions and universities.

  • Universidade Federal de Goias
  • Periyar University
  • Melbourne University
  • Kyung Hee University
  • Universidad de Buenos Aires
  • Seoul National University

    • Delivery

    1. Delivery will be initiated within 24 hours if your requested items are in stock. The transit time is approximately 2-3 business days.
    2. In the event items are out of stock, we will arrange to replenish our stock within 24 hours and we will keep you informed of the delivery status via email or phone.

    Shipping Rates

    1. The shipping and handling fee is 50 USD.
    2. The requested items will be shipped directly to you via FedEx, DHL or EMS.
    3. Packages and products should be inspected immediately upon reception. Notification of damage, shortage or defects should be sent to us immediately by e-mail or fax.

    Quick Contact

    If you find the right products of peptide-online, please do not hesitate to contact me!

    Tel: +86-27-84396673
    Fax: +86-27-84254680
    Email: peptide-online@hotmail.com
    Website: www.peptide-online.com

    © Copyright 2011 Peptide-online.com. All Rights Reserved