EMAIL: peptide-online@hotmail.com | Product Catalog
Product  >  Other Peptide  >  Galanin, Porcine
Galanin, Porcine
Catalog No. Peptide Name Size Price M. W Purity Stock
P70959Pe1 Galanin, Porcine 5mg USD 464 3210.55 > 98% In Stock Inquiry
P70959Pe1 Galanin, Porcine 10mg USD 522 3210.55 > 98% In Stock Inquiry
P70959Pe1 Galanin, Porcine 20mg USD 725 3210.55 > 98% In Stock Inquiry
P70959Pe1 Galanin, Porcine 50mg USD 1218 3210.55 > 98% In Stock Inquiry
P70959Pe1 Galanin, Porcine 100mg USD 1740 3210.55 > 98% 1-3 days Inquiry
P70959Pe1 Galanin, Porcine 200mg USD 2320 3210.55 > 98% 3-5 days Inquiry
P70959Pe1 Galanin, Porcine 500mg USD 2900 3210.55 > 98% 1-2 weeks Inquiry
P70959Pe1 Galanin, Porcine 1000mg USD 4350 3210.55 > 98% 1-2 weeks Inquiry
Overview
Product Name: Galanin, Porcine
Synonym:
Catalog No.:P70959Pe1
CAS No.:88813-36-9
Sequence(one-letter):GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2
Sequence(three-letter):Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala-NH2
Molecular Formula:C146H213N43O40
Molecular Weight:3210.55
Purity:> 98%
Storage instructions:Stored at 2-8oC. Store under Desiccating conditions. The product can be stored for up to 12 months.
Description:
Leave a message: eg: mail@mail.com 
After receiving:
The packaging of the product may have turned upside down during transportation, resulting in the natural compounds adhering to the neck or cap of the vial. take the vial out of its packaging and gently shake to let the compounds fall to the bottom of the vial. for liquid products, centrifuge at 200-500 RPM to gather the liquid at the bottom of the vial. try to avoid loss or contamination during handling.
Note:
1. It is recommended that the concentration of the stock solution be around 1-2 mg of peptide per ml of solution. This is dilute enough to minimize the potential precipitation of the peptides during storage, but concentrated enough to take relatively small volumes (< 100 µl) of aliquots for the assay, and therefore minimizing the effect of the solvents initially used for solubilization.

2. Stability of peptides have no uniform standards. The stability of each peptide depends on its sequence information. We suggest Lyophilized peptides should be stored at -20 °C. It is recommended that peptides containing methionine, cysteine, or tryptophan residues be stored in oxygen-free atmosphere to avoid oxidation.

Peptide-online products have been sold to research institutions and universities.

  • Monash University Malaysia
  • National Chung Hsing University
  • University of East Anglia
  • University of British Columbia
  • Universidad de Ciencias y Artes de Chiapas
  • Florida A&M University
  • Delivery

    1. Delivery will be initiated within 24 hours if your requested items are in stock. The transit time is approximately 2-3 business days.
    2. In the event items are out of stock, we will arrange to replenish our stock within 24 hours and we will keep you informed of the delivery status via email or phone.

    Shipping Rates

    1. The shipping and handling fee is 50 USD.
    2. The requested items will be shipped directly to you via FedEx, DHL or EMS.
    3. Packages and products should be inspected immediately upon reception. Notification of damage, shortage or defects should be sent to us immediately by e-mail or fax.

    Quick Contact

    If you find the right products of peptide-online, please do not hesitate to contact me!

    Tel: +86-27-84396673
    Fax: +86-27-84254680
    Email: peptide-online@hotmail.com
    Website: www.peptide-online.com