β-Endorphin | | Other Peptide

Product > Other Peptide > β-Endorphin

β-Endorphin

β-Endorphin is an endogenous opioid neuropeptide and peptide hormone that is produced in certain neurons within the central nervous system and peripheral nervous system. It is one of three endorphins that are produced in humans, the others of which include α-endorphin and γ-endorphin.

The amino acid sequence is: Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu (31 amino acids). The first 16 amino acids are identical to α-endorphin. β-Endorphin is considered to be a part of the endogenous opioid and endorphin classes of neuropeptides; all of the established endogenous opioid peptides contain the same N-terminal amino acid sequence, Tyr-Gly-Gly-Phe, followed by either -Met or -Leu.

Function of β-endorphin has been known to be associated with hunger, thrill, pain, maternal care, sexual behavior, and reward cognition. In the broadest sense, β-endorphin is primarily utilized in the body to reduce stress and maintain homeostasis. In behavioral research, studies have shown that β-endorphin is released via volume transmission into the ventricular system in response to a variety of stimuli, and novel stimuli in particular.

Catalog No.	Peptide Name	Sequence	Purity
P80021Pe1	α-Endorphin	YGGFMTSEKSQTPLVT	> 98%
P80021Hu1	b-Endorphin (1-26), Human	YGGFMTSEKSQTPLVTLFKNAIIKNA	> 98%
P80021Hu2	b-Endorphin, Human	YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE	> 98%
P80021Ra1	b-Endorphin, Rat	YGGFMTSEKSQTPLVTLFKNAIIKNVHKKGQ	> 98%
P80021Hu3	b-Endorphin (1-27), Human	YGGFMTSEKSQTPLVTLFKNAIIKNAY	> 98%
P80021Hu4	Acetyl, b-Endorphin (1-26), Human	Ac-YGGFMTSEKSQTPLVTLFKNAIIKNA	> 98%
P80021Hu5	Acetyl, b-Endorphin, Human	Ac-YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE	> 98%
P80021Hu6	Acetyl, b-Endorphin (1-27), Human	Ac-YGGFMTSEKSQTPLVTLFKNAIIKNAY	> 98%
P80021Hu7	Biocytin-b-Endorphin, Human	Biotin-KYGGFMTSEKSQTPLVTLFKNA-lle-lle-KN...	> 98%

Delivery

1. Delivery will be initiated within 24 hours if your requested items are in stock. The transit time is approximately 2-3 business days.
2. In the event items are out of stock, we will arrange to replenish our stock within 24 hours and we will keep you informed of the delivery status via email or phone.

Shipping Rates

1. The shipping and handling fee is 50 USD.
2. The requested items will be shipped directly to you via FedEx, DHL or EMS.
3. Packages and products should be inspected immediately upon reception. Notification of damage, shortage or defects should be sent to us immediately by e-mail or fax.

Quick Contact

If you find the right products of peptide-online, please do not hesitate to contact me!

Tel: +86-27-84396673
Fax: +86-27-84254680
Email: peptide-online@hotmail.com
Website: www.peptide-online.com