EMAIL: peptide-online@hotmail.com | Product Catalog
Product  >  Other Peptide  >  p53 Peptide
p53 Peptide
Catalog No. Peptide Name Sequence Purity
P80169Hu1 [Lys(Ac)373]-p53 (368-393), p53 K373(Ac), biotin-labeled, Human Biotin-KGWHLKSK-Lys(Ac)-GQSTSRHKKLMFKTEG... > 98%
P80169Hu2 p53 Tumor Suppressor (361-393), Human GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD-NH2 > 98%
P80169Pe1 [Lys(Me3)382]-p53 (377-387); p53K382Me3 TSRHK-Lys(Me3)-LMFKT > 98%
P80169Pe2 TP53 Q9NP68, p53 Mutant Form (372-389), Lys382 (Ac) KKGQSTSRHK-Lys(Ac)-LMFKTEG > 98%
P80169Hu3 [Lys(Ac)382]-p53 (361-393), biotin labeled, amide, Human Biotin-C6-GSRAHSSHLKSKKGQSTSRHK-Lys(Ac)-... > 98%
P80169Pe3 [Lys(Ac)382]-p53 (372-389), biotin labeled, amide Biotin-LC-KKGQSTSRHK-Lys(Ac)-LMFKTEG-NH2 > 98%
P80169Hu4 [Lys(Ac)382]-p53 (368-393), p53 K382(Ac), biotin-labeled, Human Biotin-KGGHLKSKKGQSTSRHK-Lys(Ac)-LMFKTEG... > 98%
P80169Pe4 p53 (17-26), FITC labeled FITC-LC-ETFSDLWKLL-NH2 > 98%
P80169Pe5 p53 (17-26) ETFSDLWKLL > 98%
P80169Hu5 p53 Tumor Suppressor (361-393), LC-Biotin, Human Biotin-LC-GSRAHSSHLKSKKGQSTSRHKKLMFKTEGP... > 98%
P80169Pe6 [Lys(Me2)370]-p53 (361-380); p53K370Me2 GSRAHSSHL-Lys(Me2)-SKKGQSTSRH > 98%
P80169Pe7 [Lys(Me3)370]-p53 (361-380); p53K370Me3 GSRAHSSHL-Lys(Me3)-SKKGQSTSRH > 98%
P80169Hu6 [Lys(Me2)372]-p53 (368-393), p53 K372(Me2), biotin-labeled, Human Biotin-KGGHLKS-Lys(Me2)-KGQSTSRHKKLMFKTE... > 98%
P80169Pe8 [Lys(Ac)382]-p53 (374-389); p53 acetylated K382 Ac-GQSTSRHK-Lys(Ac)-LMFKTEG-NH2 > 98%
P80169Pe9 [Lys(Me1)382]-p53 (377-387); p53K382Me1 TSRHK-Lys(Me)-LMFKT > 98%
P80169Hu7 [Lys(Ac)373]-p53 (368-393), p53 K373(Ac), biotin-labeled, Human Biotin-KGGHLKSK-Lys(Ac)-GQSTSRHKKLMFKTEG... > 98%
P80169Hu8 [Lys(Me1)373]-p53 (368-393), p53 K373(Me1), biotin-labeled, Human Biotin-KGWHLKS-Lys(Me1)-KGQSTSRHKKLMFKTE... > 98%
P80169Pe10 p53 (361-380) GSRAHSSHLKSKKGQSTSRH > 98%
P80169Pe11 [Lys(Me2)382]-p53 (377-387); p53K382Me2 TSRHK-Lys(Me2)-LMFKT > 98%

Delivery

1. Delivery will be initiated within 24 hours if your requested items are in stock. The transit time is approximately 2-3 business days.
2. In the event items are out of stock, we will arrange to replenish our stock within 24 hours and we will keep you informed of the delivery status via email or phone.

Shipping Rates

1. The shipping and handling fee is 50 USD.
2. The requested items will be shipped directly to you via FedEx, DHL or EMS.
3. Packages and products should be inspected immediately upon reception. Notification of damage, shortage or defects should be sent to us immediately by e-mail or fax.

Quick Contact

If you find the right products of peptide-online, please do not hesitate to contact me!

Tel: +86-27-84396673
Fax: +86-27-84254680
Email: peptide-online@hotmail.com
Website: www.peptide-online.com