Somatostatin & Analog | | Other Peptide

Product > Other Peptide > Somatostatin & Analog

Somatostatin & Analog

Somatostatin, also known as growth hormone-inhibiting hormone (GHIH) or by several other names, is a peptide hormone that regulates the endocrine system and affects neurotransmission and cell proliferation via interaction with G protein-coupled somatostatin receptors and inhibition of the release of numerous secondary hormones. Somatostatin inhibits insulin and glucagon secretion.

Somatostatin has two active forms produced by the alternative cleavage of a single preproprotein: one consisting of 14 amino acids (shown in infobox to right), the other consisting of 28 amino acids.

Among the vertebrates, there exist six different somatostatin genes that have been named SS1, SS2, SS3, SS4, SS5 and SS6. Zebrafish have all six. The six different genes, along with the five different somatostatin receptors, allow somatostatin to possess a large range of functions. Humans have only one somatostatin gene, SST.

Catalog No.	Peptide Name	Sequence	Purity
P80076Pe1	DOTA-(Tyr3)-Octreotate	DOTA-fCYwKTCT(Cys & Cys bridge)	> 98%
P80076Po1	Prosomatostatin (1-32), Porcine	APSDPRLRQFLQKSLAAAAGKQELAKYFLAEL	> 98%
P80076Pe2	DOTA-[Tyr3] - Octreotide	DOTA-DPhe-CF-DTrp-KTCT-ol (Cys2&Cys7 bri...	> 98%
P80076Pe3	(Ac-Nle4, Asp5, DPhe7, Lys10)-Cyclo-a-MSH (4-10) amide, MTII	Ac-Nle-cyclo(Asp-H-DPhe-RWK-NH2)Peptide ...	> 98%
P80076Pe4	CTOP	DPhe-CY-DTrp-Orn-T-Pen-T-ol(Cys2&Pen7 br...	> 98%
P80076Pe5	Octreotide (SMS 201-995)	DPhe-CF-DTrp-KTCT-ol(Cys2&Cys7 bridge)	> 98%
P80076Pe6	[D-Phe7]-Somatostatin-14	AGCKNFFWKTFTS-Cys(Cys3&Cys14 bridge)	> 98%
P80076Pe7	RC-160 (Vapreotide)	DPhe-CY-DTrp-KVCW-NH2(Cys2&Cys7 bridge)	> 98%
P80076Pe8	Somatostatin 28	SANSNPAMAPRERKAGCKNFFWKTFTS-Cys(Cys17&Cy...	> 98%
P80076Pe9	[DTrp8] Somatostatin	AGCKNFF-DTrp-KTFTS-Cys (Cys3&Cys14 bridg...	> 98%
P80076Pe10	NTB (Naltriben)	DPhe-CY-DTrp-Orn-T-Pen-T-NH2(Cys2&Pen7 b...	> 98%
P80076Pe11	Somatostatin 28 (1-14)	SANSNPAMAPRERK	> 98%

Delivery

1. Delivery will be initiated within 24 hours if your requested items are in stock. The transit time is approximately 2-3 business days.
2. In the event items are out of stock, we will arrange to replenish our stock within 24 hours and we will keep you informed of the delivery status via email or phone.

Shipping Rates

1. The shipping and handling fee is 50 USD.
2. The requested items will be shipped directly to you via FedEx, DHL or EMS.
3. Packages and products should be inspected immediately upon reception. Notification of damage, shortage or defects should be sent to us immediately by e-mail or fax.

Quick Contact

If you find the right products of peptide-online, please do not hesitate to contact me!

Tel: +86-27-84396673
Fax: +86-27-84254680
Email: peptide-online@hotmail.com
Website: www.peptide-online.com