Pancreatic Polypeptide | | Other Peptide

Product > Other Peptide > Pancreatic Polypeptide

Pancreatic Polypeptide

Pancreatic polypeptide (PP) is a polypeptide secreted by PP cells in the endocrine pancreas predominantly in the head of the pancreas. It consists of 36 amino acids and has molecular weight about 4200 Da.

The function of PP is to self-regulate pancreatic secretion activities (endocrine and exocrine); it also has effects on hepatic glycogen levels and gastrointestinal secretions.

Its secretion in humans is increased after a protein meal, fasting, exercise, and acute hypoglycemia and is decreased by somatostatin and intravenous glucose.

Catalog No.	Peptide Name	Sequence	Purity
P80162Pe1	IGRP Catalytic Subunit - related Protein (206 - 214)	VYLKTNVFL	> 98%
P80162Bo1	Pancreatic Polypeptide, Bovine	APLEPEYPGDNATPEQMAQYAAELRRYINMLTRPRY-NH2	> 98%
P80162Pe2	BDC2.5 Mimotope	RTRPLWVRME	> 98%
P80162Ra1	Pancreatic Polypeptide, Rat	APLEPMYPGDYATHEQRAQYETQLRRYINTLTRPRY-NH2	> 98%
P80162Pe3	Insulin B (9-23)	SHLVEALYLVCGERG	> 98%
P80162Hu1	Pancreatic Polypeptide, Human	APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2	> 98%
P80162Pe4	Insulin B (13 - 23)	EALYLVCGERG	> 98%

Delivery

1. Delivery will be initiated within 24 hours if your requested items are in stock. The transit time is approximately 2-3 business days.
2. In the event items are out of stock, we will arrange to replenish our stock within 24 hours and we will keep you informed of the delivery status via email or phone.

Shipping Rates

1. The shipping and handling fee is 50 USD.
2. The requested items will be shipped directly to you via FedEx, DHL or EMS.
3. Packages and products should be inspected immediately upon reception. Notification of damage, shortage or defects should be sent to us immediately by e-mail or fax.

Quick Contact

If you find the right products of peptide-online, please do not hesitate to contact me!

Tel: +86-27-84396673
Fax: +86-27-84254680
Email: peptide-online@hotmail.com
Website: www.peptide-online.com