EMAIL: peptide-online@hotmail.com | Product Catalog
Product  >  Other Peptide  >  PTH
PTH

Parathyroid hormone (PTH), also called parathormone or parathyrin, is a hormone secreted by the parathyroid glands that is important in bone remodeling, which is an ongoing process in which bone tissue is alternately resorbed and rebuilt over time. PTH is secreted in response to low blood serum calcium (Ca2+) levels. PTH indirectly stimulates osteoclast activity within bone marrow, in an effort to release more ionic calcium (Ca2+) into the blood to elevate serum calcium (Ca2+) levels. The bones act as a (metaphorical) "bank of calcium" from which the body can make "withdrawals" as needed to keep the amount of calcium in the blood at appropriate levels despite the ever-present challenges of metabolism, stress, and nutritional variations. PTH is "a key that unlocks the bank vault" to remove the calcium. In consequence, PTH is vital to health, and health problems that yield too little or too much PTH (such as hypoparathyroidism, hyperparathyroidism, or paraneoplastic syndromes) can wreak havoc in the form of bone disease, hypocalcaemia, and hypercalcaemia.

 
PTH is secreted by the chief cells of the parathyroid glands as a polypeptide containing 84 amino acids, which is a prohormone; effective hormone-receptor interaction requires solely the 34-N-terminal amino acids. (Data indicate that PTH is also possibly secreted in small amounts from the brain and the thymus.) While PTH acts to increase the concentration of ionic calcium (Ca2+) in the blood, calcitonin, a hormone produced by the parafollicular cells (C cells) of the thyroid gland, acts to decrease ionic calcium concentration. PTH essentially acts to increase the concentration of calcium in the blood by acting upon the parathyroid hormone 1 receptor, which is present at high levels in bone and kidney, and the parathyroid hormone 2 receptor, which is present at high levels in the central nervous system, pancreas, testis, and placenta. PTH half-life is approximately 4 minutes. It has a molecular mass of approximately 9500 Da.
Catalog No. Peptide Name Sequence Purity
P80069Bo1 Parathyroid Hormone (1-34), Bovine AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF > 98%
P80069Hu1 [Nle8,18,Tyr34] Parathyroid Hormone (3-34), amide, Human SEIQL-Nle-HNLGKHLNS-Nle-ERVEWLRKKLQDVHNY... > 98%
P80069Hu2 Hypercalcemia Malignancy Factor (1-34), amide, Human AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA-NH2 > 98%
P80069Hu3 Parathyroid Hormone (1-34), Human SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF > 98%
P80069Ra1 Parathyroid Hormone (1-34), Rat AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF > 98%
P80069Hu4 Hypercalcemia Malignancy Factor (1-34), Human AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA > 98%
P80069Hu5 Biotinyl-PTH-Related Protein (1-34), Human Biotin-AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHT... > 98%
P80069Ra2 Biotinyl-PTH-Related Protein (1-34), Rat Biotin-AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHT... > 98%
P80069Hu6 [Nle8,18, Tyr34] Parathyroid Hormone (1-34), Human SVSEIQL-Nle-HNLGKHLNS-Nle-ERVEWLRKKLQDVH... > 98%
P80069Hu7 Hypercalcemia Malignancy Factor (7-34), amide, Human LLHDKGKSIQDLRRRFFLHHLIAEIHTA-NH2 > 98%

Delivery

1. Delivery will be initiated within 24 hours if your requested items are in stock. The transit time is approximately 2-3 business days.
2. In the event items are out of stock, we will arrange to replenish our stock within 24 hours and we will keep you informed of the delivery status via email or phone.

Shipping Rates

1. The shipping and handling fee is 50 USD.
2. The requested items will be shipped directly to you via FedEx, DHL or EMS.
3. Packages and products should be inspected immediately upon reception. Notification of damage, shortage or defects should be sent to us immediately by e-mail or fax.

Quick Contact

If you find the right products of peptide-online, please do not hesitate to contact me!

Tel: +86-27-84396673
Fax: +86-27-84254680
Email: peptide-online@hotmail.com
Website: www.peptide-online.com