Parathyroid hormone (PTH), also called parathormone or parathyrin, is a hormone secreted by the parathyroid glands that is important in bone remodeling, which is an ongoing process in which bone tissue is alternately resorbed and rebuilt over time. PTH is secreted in response to low blood serum calcium (Ca2+) levels. PTH indirectly stimulates osteoclast activity within bone marrow, in an effort to release more ionic calcium (Ca2+) into the blood to elevate serum calcium (Ca2+) levels. The bones act as a (metaphorical) "bank of calcium" from which the body can make "withdrawals" as needed to keep the amount of calcium in the blood at appropriate levels despite the ever-present challenges of metabolism, stress, and nutritional variations. PTH is "a key that unlocks the bank vault" to remove the calcium. In consequence, PTH is vital to health, and health problems that yield too little or too much PTH (such as hypoparathyroidism, hyperparathyroidism, or paraneoplastic syndromes) can wreak havoc in the form of bone disease, hypocalcaemia, and hypercalcaemia.
| Catalog No. | Peptide Name | Sequence | Purity |
|---|---|---|---|
| P80069Bo1 | Parathyroid Hormone (1-34), Bovine | AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF | > 98% |
| P80069Hu1 | [Nle8,18,Tyr34] Parathyroid Hormone (3-34), amide, Human | SEIQL-Nle-HNLGKHLNS-Nle-ERVEWLRKKLQDVHNY... | > 98% |
| P80069Hu2 | Hypercalcemia Malignancy Factor (1-34), amide, Human | AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA-NH2 | > 98% |
| P80069Hu3 | Parathyroid Hormone (1-34), Human | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF | > 98% |
| P80069Ra1 | Parathyroid Hormone (1-34), Rat | AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF | > 98% |
| P80069Hu4 | Hypercalcemia Malignancy Factor (1-34), Human | AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA | > 98% |
| P80069Hu5 | Biotinyl-PTH-Related Protein (1-34), Human | Biotin-AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHT... | > 98% |
| P80069Ra2 | Biotinyl-PTH-Related Protein (1-34), Rat | Biotin-AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHT... | > 98% |
| P80069Hu6 | [Nle8,18, Tyr34] Parathyroid Hormone (1-34), Human | SVSEIQL-Nle-HNLGKHLNS-Nle-ERVEWLRKKLQDVH... | > 98% |
| P80069Hu7 | Hypercalcemia Malignancy Factor (7-34), amide, Human | LLHDKGKSIQDLRRRFFLHHLIAEIHTA-NH2 | > 98% |
1. Delivery will be initiated within 24 hours if your requested items are in stock. The transit time is approximately 2-3 business days.
2. In the event items are out of stock, we will arrange to replenish our stock within 24 hours and we will keep you informed of the delivery status via email or phone.
1. The shipping and handling fee is 50 USD.
2. The requested items will be shipped directly to you via FedEx, DHL or EMS.
3. Packages and products should be inspected immediately upon reception. Notification of damage, shortage or defects should be sent to us immediately by e-mail or fax.
If you find the right products of peptide-online, please do not hesitate to contact me!
Tel: +86-27-84396673
Fax: +86-27-84254680
Email: peptide-online@hotmail.com
Website: www.peptide-online.com