Gastrin | | Other Peptide - Peptide-online

Gastrin

Gastrin is a peptide hormone that stimulates secretion of gastric acid (HCl) by the parietal cells of the stomach and aids in gastric motility. It is released by G cells in the pyloric antrum of the stomach, duodenum, and the pancreas.

Gastrin binds to cholecystokinin B receptors to stimulate the release of histamines in enterochromaffin-like cells, and it induces the insertion of K+/H+ ATPase pumps into the apical membrane of parietal cells (which in turn increases H+ release into the stomach cavity). Its release is stimulated by peptides in the lumen of the stomach.

Catalog No.	Peptide Name	Sequence	Purity
P80041Hu1	Big Gastrin I, Human	Glp-LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF-NH...	> 98%
P80041Po1	Gastrin Releasing Peptide, Porcine	APVSVGGGTVLAKMYPRGNHWAVGHLM-NH2	> 98%
P80041Hu2	Gastrin Releasing Peptide, Human	VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2	> 98%
P80041Hu3	Gastrin I, Human	Glp-GPWLEEEEEAYGWMDF-NH2	> 98%

Delivery

1. Delivery will be initiated within 24 hours if your requested items are in stock. The transit time is approximately 2-3 business days.
2. In the event items are out of stock, we will arrange to replenish our stock within 24 hours and we will keep you informed of the delivery status via email or phone.

Shipping Rates

1. The shipping and handling fee is 50 USD.
2. The requested items will be shipped directly to you via FedEx, DHL or EMS.
3. Packages and products should be inspected immediately upon reception. Notification of damage, shortage or defects should be sent to us immediately by e-mail or fax.

Quick Contact

If you find the right products of peptide-online, please do not hesitate to contact me!

Tel: +86-27-84396673
Fax: +86-27-84254680
Email: peptide-online@hotmail.com
Website: www.peptide-online.com