Gastric Inhibitory Peptide | | Other Peptide

Product > Other Peptide > Gastric Inhibitory Peptide

Gastric Inhibitory Peptide

Gastric inhibitory polypeptide (GIP) or gastroinhibitory peptide, also known as the glucose-dependent insulinotropic peptide, is an inhibiting hormone of the secretin family of hormones. While it is weak inhibitor of gastric acid secretion, its main role is to stimulate insulin secretion.

GIP, along with glucagon-like peptide-1 (GLP-1), belongs to a class of molecules referred to as incretins.

Catalog No.	Peptide Name	Sequence	Purity
P80040Po1	Gastric Inhibitory Peptide (1-30), amide, Porcine	YAEGTFISDYSIAMDKIRQQDFVNWLLAQK-NH2	> 98%
P80040Hu1	Gastric Inhibitory Peptide (GIP), Human	YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNI...	> 98%
P80040Po2	Gastric Inhibitory Peptide, Porcine	YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNI...	> 98%

Delivery

1. Delivery will be initiated within 24 hours if your requested items are in stock. The transit time is approximately 2-3 business days.
2. In the event items are out of stock, we will arrange to replenish our stock within 24 hours and we will keep you informed of the delivery status via email or phone.

Shipping Rates

1. The shipping and handling fee is 50 USD.
2. The requested items will be shipped directly to you via FedEx, DHL or EMS.
3. Packages and products should be inspected immediately upon reception. Notification of damage, shortage or defects should be sent to us immediately by e-mail or fax.

Quick Contact

If you find the right products of peptide-online, please do not hesitate to contact me!

Tel: +86-27-84396673
Fax: +86-27-84254680
Email: peptide-online@hotmail.com
Website: www.peptide-online.com