Exendins are peptide hormones isolated from an exocrine gland but have endocrine actions. Exendins stimulate insulin secretion in response to rising blood glucose levels, and modulate gastric emptying to slow the entry of ingested sugars into the bloodstream. Exendin-3 is a 39-amino acid peptide that shares homology with VIP (vasoactive intestinal peptide), secretin, helospectin I and II and helodermin. It stimulates increases in cellular cAMP and amylase release from dispersed guinea pig pancreatic acini. Exendin-4, a 39-amino acid peptide originally isolated from the oral secretions of the lizard Heloderma suspectum, has been shown to share certain activities with glucagon-like-peptide-1 (GLP-1). It is an insulinotropic agent which improves glucose tolerance in humans and animals with diabetes. Exendin-4 increases insulin sensitivity via a PI-3-kinase-dependent mechanism. In the human fetal pancreas, the proliferation and differentiation of endocrine precursor cells into insulin-producing ß-cells can be positively regulated by exendin 4. Moreover, the peptide accelerates the functional maturation of fetal ß-cells as indicated by the stimulated insulin secretion in response to glucose.
Catalog No. | Peptide Name | Sequence | Purity |
---|---|---|---|
P80036Pe1 | Exendin (9-39) | DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 | > 98% |
P80036Pe2 | [Des His1, Glu8] Exendin-4 | GEGTFTSELSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-N... | > 98% |
P80036Pe3 | Exendin-3 | HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-... | > 98% |
P80036Pe4 | Exendin-4 (3-39) | EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH... | > 98% |
P80036Pe5 | Exendin-4 | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-... | > 98% |
1. Delivery will be initiated within 24 hours if your requested items are in stock. The transit time is approximately 2-3 business days.
2. In the event items are out of stock, we will arrange to replenish our stock within 24 hours and we will keep you informed of the delivery status via email or phone.
1. The shipping and handling fee is 50 USD.
2. The requested items will be shipped directly to you via FedEx, DHL or EMS.
3. Packages and products should be inspected immediately upon reception. Notification of damage, shortage or defects should be sent to us immediately by e-mail or fax.
If you find the right products of peptide-online, please do not hesitate to contact me!
Tel: +86-27-84396673
Fax: +86-27-84254680
Email: peptide-online@hotmail.com
Website: www.peptide-online.com