Adrenomedullin consists of 52 amino acids, has 1 intramolecular disulfide bond, and shows a slight homology with the calcitonin gene-related peptide (CGRP). The precursor, called preproadrenomedullin, consists of 185 amino acids. By RNA-blot analysis, human adrenomedullin mRNA was found to be expressed in all tissues, and most highly expressed in the placenta, fat cells, lung, pancreatic islets, smooth muscle, and skin.
The human AM gene is localized to a single locus on Chromosome 11 with 4 exons and 3 introns. The AM gene initially codes for a 185-amino acid precursor peptide, that can be differentially excised to form a number of peptides, including an inactive 53-amino acid AM, e PAMP, adrenotensin and AM95-146. Mature human AM is activated to form a 52 amino acid, 6-amino acid ring, that shares moderate structural similarity to the calcitonin family of regulatory peptides (calcitonin, CGRP and amylin). Circulating AM consists of both amidated active form (15%) and the glycated inactive form (85%). It has a plasma half-life of 22min, mean clearance rate of 274 mL/kg/min, and apparent volume of distribution of 880+/- 150 mL/kg.
Mature AM is degraded by the aminopeptidase neprilysin.
Catalog No. | Peptide Name | Sequence | Purity |
---|---|---|---|
P80008Ra1 | Adrenomedullin (ADM)(1-50) | YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMA... | > 98% |
P80008Po1 | Pro-Adrenomedullin (ADM) (1-20) | ARLDVAAEFRKKWNKWALSR-NH2 | > 98% |
P80008Hu1 | Adrenomedullin (ADM)(1-12) | YRQSMNNFQGLR | > 98% |
P80008Po2 | Adrenomedullin (ADM)(1-52) | YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDG... | > 98% |
P80008Hu2 | Adrenomedullin (ADM)(22-52) | TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 | > 98% |
P80008Hu3 | Adrenomedullin (ADM)(1-52) | YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDN... | > 98% |
P80008Ra2 | Adrenomedullin (ADM)(11-50) | STGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY... | > 98% |
P80008Ra3 | Pro-Adrenomedullin (ADM)(1-20) | ARLDTSSQFRKKWNKWALSR-NH2 | > 98% |
P80008Hu4 | Adrenomedullin (ADM)(13-52) | SFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY... | > 98% |
P80008Hu5 | Pro-Adrenomedullin (ADM)(1-20) | ARLDVASEFRKKWNKWALSR-NH2 | > 98% |
P80008Hu6 | Pro-Adrenomedullin (ADM)(45-92) | ELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSS... | > 98% |
1. Delivery will be initiated within 24 hours if your requested items are in stock. The transit time is approximately 2-3 business days.
2. In the event items are out of stock, we will arrange to replenish our stock within 24 hours and we will keep you informed of the delivery status via email or phone.
1. The shipping and handling fee is 50 USD.
2. The requested items will be shipped directly to you via FedEx, DHL or EMS.
3. Packages and products should be inspected immediately upon reception. Notification of damage, shortage or defects should be sent to us immediately by e-mail or fax.
If you find the right products of peptide-online, please do not hesitate to contact me!
Tel: +86-27-84396673
Fax: +86-27-84254680
Email: peptide-online@hotmail.com
Website: www.peptide-online.com