| Catalog No. | Peptide Name | Sequence | Purity |
|---|---|---|---|
| P80021Pe1 | α-Endorphin | YGGFMTSEKSQTPLVT | > 98% |
| P80021Hu1 | b-Endorphin (1-26), Human | YGGFMTSEKSQTPLVTLFKNAIIKNA | > 98% |
| P80021Hu2 | b-Endorphin, Human | YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE | > 98% |
| P80021Ra1 | b-Endorphin, Rat | YGGFMTSEKSQTPLVTLFKNAIIKNVHKKGQ | > 98% |
| P80021Hu3 | b-Endorphin (1-27), Human | YGGFMTSEKSQTPLVTLFKNAIIKNAY | > 98% |
| P80021Hu4 | Acetyl, b-Endorphin (1-26), Human | Ac-YGGFMTSEKSQTPLVTLFKNAIIKNA | > 98% |
| P80021Hu5 | Acetyl, b-Endorphin, Human | Ac-YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE | > 98% |
| P80021Hu6 | Acetyl, b-Endorphin (1-27), Human | Ac-YGGFMTSEKSQTPLVTLFKNAIIKNAY | > 98% |
| P80021Hu7 | Biocytin-b-Endorphin, Human | Biotin-KYGGFMTSEKSQTPLVTLFKNA-lle-lle-KN... | > 98% |
1. Delivery will be initiated within 24 hours if your requested items are in stock. The transit time is approximately 2-3 business days.
2. In the event items are out of stock, we will arrange to replenish our stock within 24 hours and we will keep you informed of the delivery status via email or phone.
1. The shipping and handling fee is 50 USD.
2. The requested items will be shipped directly to you via FedEx, DHL or EMS.
3. Packages and products should be inspected immediately upon reception. Notification of damage, shortage or defects should be sent to us immediately by e-mail or fax.
If you find the right products of peptide-online, please do not hesitate to contact me!
Tel: +86-27-84396673
Fax: +86-27-84254680
Email: peptide-online@hotmail.com
Website: www.peptide-online.com